Bacterial taxon 1392858
Locus CO715_09690
Protein ATI05955.1
ribosome silencing factor RsfS
Escherichia coli M12
Length 105 aa, Gene n/a, UniProt n/a
>ATI05955.1|Escherichia coli M12|ribosome silencing factor RsfS
MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.11 | 5.1e-7 | ●●○○○ -1.35 | -1.3538134752321442 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.21 | 7.1e-5 | ●○○○○ -0.96 | -0.9586379242448011 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)