Bacterial taxon 1392858
Locus CO715_23145
Protein ATI08366.1
SAM-dependent methyltransferase
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI08366.1|Escherichia coli M12|SAM-dependent methyltransferase
MDIPRIFTISESEHRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFAGAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYDVVEMVLADQEGWDRYEAAKWLTMRRWLEANPDDDFAAEVRAELNIAPKRYVTYARECFGWGVFALIAR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.38 | 1.1e-24 | ●○○○○ -0.99 | -0.9936904546386098 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.66 | 0.028 | ○○○○○ 0.2 | 0.20080797693612087 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)