Bacterial taxon 1392858
Locus CO715_06770
Protein ATI05444.1
septum site-determining protein MinC
Escherichia coli M12
Length 231 aa, Gene n/a, UniProt n/a
>ATI05444.1|Escherichia coli M12|septum site-determining protein MinC
MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPAPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.53 | 1.5e-36 | ●○○○○ -0.61 | -0.6079039742924653 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.34 | 0.00085 | ○○○○○ 0.83 | 0.826328727654207 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)