Bacterial taxon 1392858
Locus CO715_17055
Protein ATI07273.1
serine/threonine protein phosphatase
Escherichia coli M12
Length 218 aa, Gene n/a, UniProt n/a
>ATI07273.1|Escherichia coli M12|serine/threonine protein phosphatase
MPSIRYHKIESFNYRHIWAVGDIHGDYQLLQSRLHQLSFCPETDLLISVGDNIDRGPDSLNVLRLLNQPWFTSVKGNHEAMALDAFATGDGNMWLASGGDWFFELNDSEQKEAIDLLLRFHHLPHIIEITNDIIKYVIAHADYPGDEYQFGKEVAEREVLWPVDRVQKSLKGELKEINGADCFIFGHMMFTNIQTFANQVYIDTGSPESGRLSFYKIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.14 | 1.5e-13 | ○○○○○ 0.31 | 0.30826067427428444 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.29 | 9.1e-18 | ○○○○○ 0.81 | 0.8148531968705196 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)