Bacterial taxon 1392858
Locus CO715_04785
Protein ATI05110.1
SirA-like protein
Escherichia coli M12
Length 77 aa, Gene n/a, UniProt n/a
>ATI05110.1|Escherichia coli M12|SirA-like protein
MKNIVPDYRLDMVGEPCPYPAVATLEAMPQLKKGEILEVVSDCPQSINNIPLDARNHGYTVLDIQQDGPTIRYLIQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.59 | 0.0043 | ●○○○○ -0.83 | -0.829277395410507 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.32 | 0.011 | ○○○○○ 1.45 | 1.4480938501158136 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)