Bacterial taxon 1392858
Locus CO715_06495
Protein ATI05395.1
small toxic polypeptide LdrA/LdrC
Escherichia coli M12
Length 35 aa, Gene n/a, UniProt n/a
>ATI05395.1|Escherichia coli M12|small toxic polypeptide LdrA/LdrC
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.66 | 5.6e-5 | ●○○○○ -0.01 | -0.00804668332698928 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.83 | 0.0086 | ○○○○○ 0.93 | 0.9273133985506558 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)