Bacterial taxon 1392858
Locus CO715_06500
Protein ATI05396.1
small toxic polypeptide LdrA/LdrC
Escherichia coli M12
Length 35 aa, Gene n/a, UniProt n/a
>ATI05396.1|Escherichia coli M12|small toxic polypeptide LdrA/LdrC
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.46 | 9.7e-11 | ●●○○○ -1.43 | -1.4276741642762414 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.64 | 9.0e-9 | ●○○○○ -0.63 | -0.6300204518028446 | 29101196 |
Retrieved 2 of 2 entries in 2.6 ms
(Link to these results)