Bacterial taxon 1392858
Locus CO715_04780
Protein ATI05109.1
SOS response-associated peptidase
Escherichia coli M12
Length 222 aa, Gene n/a, UniProt n/a
>ATI05109.1|Escherichia coli M12|SOS response-associated peptidase
MCGRFAQSQTREDYLALLAEDIERDIPYDPEPIGRYNVAPGTKVLLLSERDEHLHLDPVFWGYAPGWWDKPPLINARVETAATSRMFKPLWQHGRAICFADGWFEWKKEGDKKQPYFIYRADGQPVFLAAIGSTPFERGDEAEGFLIVTAAADQGLVDIHDRRPLVLSPEAARKWMRQEIGGKEASEIATSGCVPANQFTWHPVSRAVGNVKNQGAELIQPI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.84 | 2.1e-16 | ●●○○○ -1.3 | -1.2983136354419473 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.27 | 0.039 | ○○○○○ 0.81 | 0.8100543385427956 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)