Bacterial taxon 1392858
Locus CO715_07210
Protein ATI05524.1
spermidine/putrescine ABC transporter substrate-binding protein PotD
Escherichia coli M12
Length 348 aa, Gene n/a, UniProt n/a
>ATI05524.1|Escherichia coli M12|spermidine/putrescine ABC transporter substrate-binding protein PotD
MKKWSRHLLAAGALALGMSAAHADDNNTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYESNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKQGMIQKIDKSKLSNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSLLLTDDAREVFQMALRKLGYSGNTTDPKEIEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAETIGYPTPNLAARKLLSPEVANDKTLYPDAETIKNGEWQNDVGAASSIYEEYYQKLKAGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.26 | 3.9e-214 | ●○○○○ -0.97 | -0.9682356409002487 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.52 | 4.4e-82 | ○○○○○ 1.28 | 1.280342454659729 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)