Bacterial taxon 1392858
Locus CO715_07615
Protein ATI05595.1
stationary-phase-induced ribosome-associated protein
Escherichia coli M12
Length 45 aa, Gene n/a, UniProt n/a
>ATI05595.1|Escherichia coli M12|stationary-phase-induced ribosome-associated protein
MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.63 | 2.1e-8 | ●●○○○ -1.88 | -1.8810619532390165 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.83 | 3.1e-6 | ●●○○○ -1.5 | -1.5040386054913246 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)