Bacterial taxon 1392858
Locus CO715_06040
Protein ATI05316.1
stress protection protein MarC
Escherichia coli M12
Length 221 aa, Gene n/a, UniProt n/a
>ATI05316.1|Escherichia coli M12|stress protection protein MarC
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYYAGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIAFVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.67 | 0.002 | ●○○○○ -0.64 | -0.6366971242588081 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.86 | 2.1e-9 | ○○○○○ 1.77 | 1.769200066044811 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)