Bacterial taxon 1392858
Locus CO715_13155
Protein ATI06571.1
stringent starvation protein A
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI06571.1|Escherichia coli M12|stringent starvation protein A
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.97 | 3.7e-11 | ●●○○○ -1.12 | -1.1161656650026912 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.82 | 0.003 | ○○○○○ 1.13 | 1.1340815986712771 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)