Bacterial taxon 1392858
Locus CO715_03025
Protein ATI04801.1
sulfate transporter CysZ
Escherichia coli M12
Length 253 aa, Gene n/a, UniProt n/a
>ATI04801.1|Escherichia coli M12|sulfate transporter CysZ
MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPTLMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAMWVDCYRDKHAMWR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.42 | 3.7e-13 | ●●○○○ -1 | -1.0028708792655598 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.21 | 4.8e-10 | ●○○○○ -0.54 | -0.5409286037185809 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)