Bacterial taxon 1392858
Locus CO715_15235
Protein ATI06947.1
sulfofructosephosphate aldolase
Escherichia coli M12
Length 292 aa, Gene n/a, UniProt n/a
>ATI06947.1|Escherichia coli M12|sulfofructosephosphate aldolase
MNKYTINDITRASGGFAMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKTLSPYASAILVDQQFCYRQVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDRKINPLQIKQDGGKALKLLVLWRSDEDAQQRLDMVKEFNELCHSHGLVSIIEPVVRPPRRGDKFDREQAIIDAAKELGDSGADLYKVEMPLYGKGPQQELLSASQRLNDHINMPWVILSSGVDEKLFPRAVRVAMTAGASGFLAGRAVWASVVGLPDNELMLRDVCAPKLQQLGDIVDEMMAKRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.43 | 0.035 | ●○○○○ -0.17 | -0.1689127603128613 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 13.28 | 2.6e-68 | ○○○○○ 3.32 | 3.3169361997428637 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)