Bacterial taxon 1392858
Locus CO715_06170
Protein ATI05340.1
superoxide dismutase
Escherichia coli M12
Length 102 aa, Gene n/a, UniProt n/a
>ATI05340.1|Escherichia coli M12|superoxide dismutase
MRILCLDIPAPGASLEKYAPHLNAEALHAWGLYKSGFIRDIYFRQDRPGVAIFLECDSVDEAMNVMAEFPLAKAGLLSFECIPLGSFINWENLFADEFKNKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.11 | 1.1e-32 | ●○○○○ -0.94 | -0.937773322819915 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.04 | 3.7e-19 | ○○○○○ 1.18 | 1.179775075791778 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)