Bacterial taxon 1392858
Locus CO715_10640
Protein ATI08788.1
superoxide dismutase [Cu-Zn] SodC2
Escherichia coli M12
Length 173 aa, Gene n/a, UniProt n/a
>ATI08788.1|Escherichia coli M12|superoxide dismutase [Cu-Zn] SodC2
MKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.67 | 0.001 | ●●○○○ -1.68 | -1.6790926114461189 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.88 | 0.0095 | ●●○○○ -1.31 | -1.3074940600688973 | 29101196 |
Retrieved 2 of 2 entries in 2.7 ms
(Link to these results)