Bacterial taxon 1392858
Locus CO715_10690
Protein ATI06123.1
superoxide dismutase [Fe]
Escherichia coli M12
Length 193 aa, Gene n/a, UniProt n/a
>ATI06123.1|Escherichia coli M12|superoxide dismutase [Fe]
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNLAA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.04 | 0.00015 | ●●○○○ -1.34 | -1.339416900248973 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.24 | 0.0017 | ●○○○○ -0.96 | -0.963436782572525 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)