Bacterial taxon 1392858
Locus CO715_19035
Protein ATI07625.1
tellurite resistance methyltransferase TehB
Escherichia coli M12
Length 197 aa, Gene n/a, UniProt n/a
>ATI07625.1|Escherichia coli M12|tellurite resistance methyltransferase TehB
MIIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYEVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.91 | 1.4e-13 | ●●○○○ -1.1 | -1.1048987802332528 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.52 | 2.9e-13 | ○○○○○ 1.49 | 1.4885711768800927 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)