Bacterial taxon 1392858
Locus CO715_22170
Protein ATI08198.1
thiol reductase thioredoxin
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI08198.1|Escherichia coli M12|thiol reductase thioredoxin
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.94 | 2.4e-7 | ●●○○○ -1.32 | -1.3181350067955893 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.46 | 4.7e-5 | ●○○○○ -0.8 | -0.8011101834869109 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)