Bacterial taxon 1392858   Locus CO715_17950   Protein ATI07435.1

thiol:disulfide interchange protein DsbC

Escherichia coli M12

Length 236 aa, Gene n/a, UniProt n/a

>ATI07435.1|Escherichia coli M12|thiol:disulfide interchange protein DsbC
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAIVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study5.740.0088○○○○○ 1.741.744371190349196529101196
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study3.040.18○○○○○ 1.181.181026951877271129101196
Retrieved 2 of 2 entries in 11.8 ms (Link to these results)