Bacterial taxon 1392858
Locus CO715_19355
Protein ATI07684.1
thiosulfate sulfurtransferase PspE
Escherichia coli M12
Length 104 aa, Gene n/a, UniProt n/a
>ATI07684.1|Escherichia coli M12|thiosulfate sulfurtransferase PspE
MFKKGLLALTLVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIASAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAMPKVKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.02 | 0.012 | ●○○○○ -0.29 | -0.29180526270544055 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 10.7 | 2.7e-17 | ○○○○○ 2.78 | 2.7775862529095576 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)