Bacterial taxon 1392858
Locus CO715_15845
Protein ATI07051.1
threonine export protein RhtC
Escherichia coli M12
Length 206 aa, Gene n/a, UniProt n/a
>ATI07051.1|Escherichia coli M12|threonine export protein RhtC
MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGLHLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLLTNLANPKAIIYFGSVFSLFVGDNVGTTERWGIFALIIIETLAWFTVVASLFALPQMRRGYQRLAKWIDGFAGALFAGFGIHLIISR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7 | 0.014 | ●○○○○ -0.91 | -0.9135703851670472 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.14 | 0.043 | ●○○○○ -0.53 | -0.5267406747496584 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)