Bacterial taxon 1392858
Locus CO715_08740
Protein ATI05794.1
threonine/homoserine exporter RhtA
Escherichia coli M12
Length 295 aa, Gene n/a, UniProt n/a
>ATI05794.1|Escherichia coli M12|threonine/homoserine exporter RhtA
MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLLLIAFFKPWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFVWVVLAVLGLWFLLPLGQDVSHVDLTGCALALGAGACWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.58 | 1.3e-7 | ○○○○○ 0.22 | 0.21583048996203888 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.67 | 4.2e-25 | ○○○○○ 0.9 | 0.8951819123563312 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)