Bacterial taxon 1392858
Locus CO715_12005
Protein ATI06367.1
thymidylate kinase
Escherichia coli M12
Length 237 aa, Gene n/a, UniProt n/a
>ATI06367.1|Escherichia coli M12|thymidylate kinase
MNQRNMSIINSTPVRVIAIVGCDGSGKSTLTASLVNELAARMPTEHIYLGQSSGRIGEWISQLPVIGAPFGRYLRSKAAHVHEKPSTPPGNITALVIYLLSCWRAYKFRKMLCKSQQGFLLITDRYPQVEVPGFRFDGPQLAKTTGGNGWIKMLRQRELKLYQWMASYLPVLLIRLGIDEQTAFARKPDHQLAALQEKIAVTPQLTFNGAKILELDGRHPADEILQASQRAIHAALS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.56 | 2.7e-71 | ●○○○○ -0.2 | -0.1958280961509644 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.02 | 3.0e-55 | ●○○○○ -0.08 | -0.08461977055632136 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)