Bacterial taxon 1392858
Locus CO715_11815
Protein ATI06331.1
TIGR00156 family protein
Escherichia coli M12
Length 130 aa, Gene n/a, UniProt n/a
>ATI06331.1|Escherichia coli M12|TIGR00156 family protein
MKKFAAVIAVMALCSAPVMAAEQGGFSGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVNP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.63 | 8.7e-11 | ●○○○○ -0.84 | -0.8369972979377149 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.11 | 3.3e-6 | ○○○○○ 1.2 | 1.1954235268604425 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)