Bacterial taxon 1392858
Locus CO715_00660
Protein ATI04374.1
transcriptional regulator
Escherichia coli M12
Length 107 aa, Gene n/a, UniProt n/a
>ATI04374.1|Escherichia coli M12|transcriptional regulator
MTAKTKFKSPAFEAIHSAAAGLSSVDAISAETMRTFDKACLTSVQDLQPVEIKALREKLKVSQPVFAHYLNTSVSTVQKWESGAKRPNGISLKLLSIVQKHGLEVLL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.52 | 3.8e-8 | ●●○○○ -1.44 | -1.4404015711454219 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.54 | 0.013 | ○○○○○ 1.08 | 1.0764952987385916 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)