Bacterial taxon 1392858
Locus CO715_08610
Protein ATI05770.1
transcriptional regulator
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI05770.1|Escherichia coli M12|transcriptional regulator
MSDKLQMMLEDAKELNALGLMSDSEVDAIAVMVKAREVSARIAKVKSMTGEEIKAIRTRYGMSQSVLAHTMGMSKESVSKWERNEIKPSGPALRILNTLAIKGPEVFAK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.45 | 2.9e-12 | ○○○○○ 0.85 | 0.8492797892215818 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.74 | 1.5e-47 | ○○○○○ 1.12 | 1.1175985635456172 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)