Bacterial taxon 1392858
Locus CO715_14395
Protein ATI06792.1
transcriptional regulator
Escherichia coli M12
Length 117 aa, Gene n/a, UniProt n/a
>ATI06792.1|Escherichia coli M12|transcriptional regulator
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRECGLLLDRKQGKWVHYRLSPHIPAWAAKIIEQTRLSQLDDVQAIARKLAAANCSADGKASCS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.27 | 1.1e-6 | ●○○○○ -0.97 | -0.9711566850997329 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.1 | 2.3e-10 | ○○○○○ 1.19 | 1.1937543587464516 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)