Bacterial taxon 1392858
Locus CO715_16675
Protein ATI07206.1
transcriptional regulator
Escherichia coli M12
Length 220 aa, Gene n/a, UniProt n/a
>ATI07206.1|Escherichia coli M12|transcriptional regulator
MTITSLDGYRWLKNDIIRGNFQPDEKLRMSLLTSRYALGVGPLREALSQLVAERLVTVVNQKGYRVASMSEQELLDIFDARANMEAMLVSLAIARGGDEWEADVLAKAHLLSKLEACDASEKMLDEWDLRHQAFHTAIVAGCGSHYLLQMRERLFDLAARYRFIWLRRTVLSVEMLEDKHDQHQTLTAAVLARDTARASELMRQHLLTPIPIIQQAMAGN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.26 | 1.5e-7 | ●●○○○ -1.39 | -1.3853190233837223 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.74 | 3.4e-7 | ○○○○○ 0.91 | 0.9093698413252537 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)