Bacterial taxon 1392858
Locus CO715_17610
Protein ATI08848.1
transcriptional regulator
Escherichia coli M12
Length 210 aa, Gene n/a, UniProt n/a
>ATI08848.1|Escherichia coli M12|transcriptional regulator
MGLCSRYKSLTCNSCSMHCQIMPEESPRLQYCANSCFCMWPEESSYFNRGVVEGILTKNHNARLSGYIFVDFSVSFLRLFLEKDWIDYLASTDMGIVLVSDRNMQSLANYWRKHNSAISAVIYNDDGLDVANEKIRQLFIGRYLSFTRGNTLTQMEFTIMGYMVSGYNPYQIAEVLDMDIRSIYAYKQRIEKRMGGKINELFIRSHSVQH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4 | 7.6e-23 | ●○○○○ -0.29 | -0.2890928645202054 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.59 | 5.4e-10 | ○○○○○ 0.01 | 0.005723953613435622 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)