Bacterial taxon 1392858
Locus CO715_22705
Protein ATI08288.1
transcriptional regulator
Escherichia coli M12
Length 75 aa, Gene n/a, UniProt n/a
>ATI08288.1|Escherichia coli M12|transcriptional regulator
MIDLENQEREVINLMFSQGISWLAAVRIRHKLSLAEVSKMLGISINSLKRIEKTERLSSNIKRKWQEFMVVHQSC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.61 | 4.7e-6 | ○○○○○ 0 | 0.0015510333284583934 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.19 | 6.3e-5 | ○○○○○ 0.09 | 0.08980829735572672 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)