Bacterial taxon 1392858
Locus CO715_23485
Protein ATI08411.1
transcriptional regulator
Escherichia coli M12
Length 135 aa, Gene n/a, UniProt n/a
>ATI08411.1|Escherichia coli M12|transcriptional regulator
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRNQLLALANACPGDDSADCPIIENLSGCCHHRAG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.59 | 9.1e-26 | ●○○○○ -0.2 | -0.20187883056418135 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.03 | 1.9e-21 | ○○○○○ 1.18 | 1.1776886156492894 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)