Bacterial taxon 1392858
Locus CO715_14270
Protein ATI06769.1
transcriptional regulator GadE
Escherichia coli M12
Length 175 aa, Gene n/a, UniProt n/a
>ATI06769.1|Escherichia coli M12|transcriptional regulator GadE
MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKFLEKLDAERIIVLAPYHISKLKAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQFKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKLRRMSDIVTLGITSYF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.12 | 7.2e-45 | ○○○○○ 1.2 | 1.19771863301718 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.43 | 0.0052 | ○○○○○ 1.26 | 1.2607297293203361 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)