Bacterial taxon 1392858
Locus CO715_18385
Protein ATI07513.1
tRNA (guanosine(46)-N7)-methyltransferase TrmB
Escherichia coli M12
Length 239 aa, Gene n/a, UniProt n/a
>ATI07513.1|Escherichia coli M12|tRNA (guanosine(46)-N7)-methyltransferase TrmB
MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -12.44 | 4.6e-14 | ●●●○○ -2.05 | -2.0496479327520967 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.07 | 2.0e-8 | ●○○○○ -0.3 | -0.3022375634178836 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)