Bacterial taxon 1392858
Locus CO715_13960
Protein ATI06713.1
tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO
Escherichia coli M12
Length 235 aa, Gene n/a, UniProt n/a
>ATI06713.1|Escherichia coli M12|tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO
MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQADAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNTRMGVFATRSTFRPNPIGMSLVELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAVSFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRVTDAGFEVFALEPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.89 | 0.038 | ●○○○○ -0.06 | -0.05645255863272504 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.63 | 0.042 | ○○○○○ 1.1 | 1.0950647940067402 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)