Bacterial taxon 1392858
Locus CO715_12375
Protein ATI06430.1
tRNA-binding protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI06430.1|Escherichia coli M12|tRNA-binding protein
METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGEKTLQTVTSLVPYYSEEELMEKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRIV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.19 | 2.0e-29 | ●●○○○ -1.16 | -1.1622764341516898 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.91 | 0.0031 | ○○○○○ 0.36 | 0.3562492575515225 | 29101196 |
Retrieved 2 of 2 entries in 2.5 ms
(Link to these results)