Bacterial taxon 1392858
Locus CO715_15920
Protein ATI07066.1
twin-arginine translocase subunit TatB
Escherichia coli M12
Length 171 aa, Gene n/a, UniProt n/a
>ATI07066.1|Escherichia coli M12|twin-arginine translocase subunit TatB
MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNEAAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.2 | 1.4e-5 | ●●○○○ -1.37 | -1.3734262005715372 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.4 | 0.00066 | ●○○○○ -1 | -0.9968201448523427 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)