Bacterial taxon 1392858
Locus CO715_01680
Protein ATI04554.1
two-component system response regulator BasR
Escherichia coli M12
Length 222 aa, Gene n/a, UniProt n/a
>ATI04554.1|Escherichia coli M12|two-component system response regulator BasR
MKILIVEDDTLLLQGLILAAQTEGYACDGVTTARMAEQSLEAGHYSLVVLDLGLPDEDGLHFLARIRQKKYTLPVLILTARDTLTDKIAGLDVGADDYLVKPFALEELHARIRALLRRHNNQGESELIVGNLTLNMGRRQVWMGGEELILTPKEYALLSRLMLKAGSPVHREILYNDIYNWDNEPSTNTLEVHIHNLRDKVGKARIRTVRGFGYMLVANEEN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.62 | 5.1e-33 | ●●○○○ -1.04 | -1.042930914001341 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.22 | 5.3e-22 | ○○○○○ 1.22 | 1.2177486503850705 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)