Bacterial taxon 1392858
Locus CO715_24795
Protein ATI08641.1
two-component system sensor histidine kinase NtrB
Escherichia coli M12
Length 349 aa, Gene n/a, UniProt n/a
>ATI08641.1|Escherichia coli M12|two-component system sensor histidine kinase NtrB
MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.92 | 9.3e-17 | ●●○○○ -1.52 | -1.524277268873464 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.08 | 9.7e-13 | ●●○○○ -1.14 | -1.1386994345415682 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)