Bacterial taxon 1392858
Locus CO715_08605
Protein ATI05769.1
type II toxin-antitoxin system RelE/ParE family toxin
Escherichia coli M12
Length 128 aa, Gene n/a, UniProt n/a
>ATI05769.1|Escherichia coli M12|type II toxin-antitoxin system RelE/ParE family toxin
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSGLSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.92 | 7.3e-25 | ●○○○○ -0.69 | -0.689693211878019 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.22 | 5.2e-10 | ●○○○○ -0.13 | -0.12634897340609355 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)