Bacterial taxon 1392858
Locus CO715_23070
Protein ATI08355.1
type-1 fimbrial protein subunit A
Escherichia coli M12
Length 182 aa, Gene n/a, UniProt n/a
>ATI08355.1|Escherichia coli M12|type-1 fimbrial protein subunit A
MKIKTLAIVVLSALSLSSTAALAAATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAAGFNIQLNDCDTNVASKAAVAFLGTAIDVGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.98 | 6.2e-10 | ○○○○○ 0.96 | 0.9584016546737361 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.86 | 1.1e-35 | ○○○○○ 1.35 | 1.3521166835613372 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)