Bacterial taxon 1392858
Locus CO715_14440
Protein ATI06801.1
universal stress protein A
Escherichia coli M12
Length 144 aa, Gene n/a, UniProt n/a
>ATI06801.1|Escherichia coli M12|universal stress protein A
MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKVSLIHVDVNYSDLYTGLIDVNLGDMQKRISEETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.59 | 3.2e-12 | ●○○○○ -0.83 | -0.8284428113535117 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.55 | 0.00018 | ○○○○○ 1.29 | 1.286393189072946 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)