Bacterial taxon 1392858
Locus CO715_14445
Protein ATI06802.1
universal stress protein B
Escherichia coli M12
Length 111 aa, Gene n/a, UniProt n/a
>ATI06802.1|Escherichia coli M12|universal stress protein B
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.02 | 9.1e-9 | ●○○○○ -0.29 | -0.29263984676243593 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.04 | 0.0057 | ○○○○○ 0.97 | 0.970711769514419 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)