Bacterial taxon 1392858
Locus CO715_19290
Protein ATI07671.1
universal stress protein UspE
Escherichia coli M12
Length 316 aa, Gene n/a, UniProt n/a
>ATI07671.1|Escherichia coli M12|universal stress protein UspE
MAMYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAMRQGVISQRTDWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHDRLEAVIFTPTDWHLLRKCPSPVWMVKDQPWPEGGKALVAVNLASEEPYHNALNEKLVKETIELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINENMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIKPDQYQTPVELDDEEDD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.72 | 4.1e-20 | ●●○○○ -1.27 | -1.2730674677178349 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.13 | 2.3e-17 | ●●○○○ -1.15 | -1.1510095493822512 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)