Bacterial taxon 1392858
Locus CO715_00825
Protein ATI04405.1
YceK/YidQ family lipoprotein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI04405.1|Escherichia coli M12|YceK/YidQ family lipoprotein
MIRNVLLAFMICSGMTLLGGCSSVMSHTGGKEGTYPGTRASATMIGDDETNWGTKSLAILDMPFTAVMDTLLLPWDVFRKDSSVRSRVEKSEANAQATNAVIPPARMPDN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.75 | 2.3e-27 | ●○○○○ -0.86 | -0.8628694037045739 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.03 | 1.5e-22 | ○○○○○ 1.18 | 1.1789404917347823 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)