Bacterial taxon 1392858
Locus CO715_18325
Protein ATI07501.1
YggS family pyridoxal phosphate enzyme
Escherichia coli M12
Length 234 aa, Gene n/a, UniProt n/a
>ATI07501.1|Escherichia coli M12|YggS family pyridoxal phosphate enzyme
MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.95 | 3.1e-6 | ●●○○○ -1.11 | -1.112201390731963 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.9 | 8.5e-5 | ○○○○○ 1.36 | 1.3598365860885453 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)