Bacterial taxon 1392858
Locus CO715_15965
Protein ATI07075.1
YigZ family protein
Escherichia coli M12
Length 204 aa, Gene n/a, UniProt n/a
>ATI07075.1|Escherichia coli M12|YigZ family protein
MESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYSQLTGIEALLGQCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.51 | 0.021 | ○○○○○ 0.44 | 0.43908172520832045 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.61 | 0.0095 | ○○○○○ 0.67 | 0.6738084912382893 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)