Bacterial taxon 1392858
Locus CO715_22735
Protein ATI08294.1
YjjW family glycine radical enzyme activase
Escherichia coli M12
Length 287 aa, Gene n/a, UniProt n/a
>ATI08294.1|Escherichia coli M12|YjjW family glycine radical enzyme activase
MNSRCALVSKIIPFSCVDGPGSRLALFLQGCNLRCKNCHNPWTMGRCNDCGECVPQCPHQALQIVDGKVLWNAVVCEQCDTCLKMCPQHATPMAQSMSVDEVLSHVRKAVLFIEGITVSGGEATTQLPFVVALFTAIKNDPQLRHLTCLVDSNGMLSETGWEKLLPVCDGAMLDLKAWGSECHQHLTGRDNQQIKRSICLLAERGKLAELRLLVIPDQVDYLHHIDELATFIKRLGDVPVRLNAFHAHGVYGEAQSWASATPEDVEPLADALKVRGVSRLIFPALYL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.66 | 6.4e-85 | ●●○○○ -1.89 | -1.8858608115667408 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.83 | 2.3e-17 | ●○○○○ -0.25 | -0.2534143960836501 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)