Bacterial taxon 155864
Locus Z0269
Protein AAG54538.1
hypothetical protein
Escherichia coli O157:H7 str. EDL933
Length 203 aa, Gene n/a, UniProt n/a
>AAG54538.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MKVFTFLLIIMVCLYNFGVRAAMDNSKHSDEAEKLLAELSARKGEGEGEGEGEGEGEGEGEPKSTVSVFYLQPEEVNTLSHQAKRGDGEAGFRLFLYYKLSNYDEEKSSQWLKIAANNGHATAQYRLYVELQEQGETKEANEWLQKIKLAASNNDSSAIWFLVNCYKNQGNKKEALQWAYKLKASKQPLDADRLIEELTKEQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 271,359 | 2.87 | 0.037 | ○○○○○ 1.77 | 1.7676040813969225 | 21278291 |
Retrieved 1 of 1 entries in 45.3 ms
(Link to these results)