Bacterial taxon 155864   Locus Z0395   Protein AAG54651.1

hypothetical protein

Escherichia coli O157:H7 str. EDL933

Length 127 aa, Gene n/a, UniProt n/a

>AAG54651.1|Escherichia coli O157:H7 str. EDL933|hypothetical protein
MTRKYLTQDEVYRLMDAAQSMSFPERNRCLIMMAFIHGFRASELLDLRLSDIDASGKQLNIRRIKNGFSTTHPLLPDEYNLIKLWLKQRKLIENGVEGDWLFLSRKRRPISRQHFFLSFVRLEDVQD

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Cow (Bos taurus)feces BTO:00004405 days372,107 -5.290.03●●○○○ -1.88-1.883966216271047521278291
Retrieved 1 of 1 entries in 15.8 ms (Link to these results)